PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_DACD935B2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 253aa    MW: 27383.6 Da    PI: 7.6447
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_DACD935B2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W+teEd +l + ++++G g+W+ I+r  g  R +k+c++rw++yl
  Traes_4AL_DACD935B2.1 14 RGPWSTEEDAKLTNHIAKHGLGRWSDIPRLAGIERGGKSCRLRWLNYL 61
                           89******************************6699**********97 PP

2Myb_DNA-binding37.84.6e-1271109545
                            -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++eE++l+++++   G+  W++Ia++++ gRt++ +k++w+
  Traes_4AL_DACD935B2.1  71 SQEEEDLIIQLHSIIGNS-WTLIAACLP-GRTDNGVKNFWN 109
                            89**************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.669961IPR017930Myb domain
SuperFamilySSF466891.2E-2813108IPR009057Homeodomain-like
SMARTSM007173.2E-121363IPR001005SANT/Myb domain
PfamPF002495.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-221568IPR009057Homeodomain-like
CDDcd001677.05E-111661No hitNo description
PROSITE profilePS5129420.2462116IPR017930Myb domain
SMARTSM007172.0E-866114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2069116IPR009057Homeodomain-like
PfamPF002491.3E-1071109IPR001005SANT/Myb domain
CDDcd001679.95E-971109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSKAPRGPRK PATRGPWSTE EDAKLTNHIA KHGLGRWSDI PRLAGIERGG KSCRLRWLNY  60
LRPDLKRAAL SQEEEDLIIQ LHSIIGNSWT LIAACLPGRT DNGVKNFWNA SIKHKLRRRG  120
IDPDTHEPVV DEGSRNGDAQ YILPSHLEAG SNACSHGALT LPDSITRYVD TDPLQLQHGV  180
VLVQPAVSSS STVGSDPSGS GSDTGEQWNN LVDGSQLFDL TESSTTTTTK SGTTNHACSI  240
ADWKLVGAAP RVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.13e-62PREDICTED: myb-related protein Zm1-like
TrEMBLW5DUA20.0W5DUA2_WHEAT; Uncharacterized protein
STRINGSi029872m2e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-54myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]